PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.M00176.1.p
Common NameLOC105968183, MIMGU_mgv1a022879mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family NF-YB
Protein Properties Length: 199aa    MW: 20201.1 Da    PI: 6.516
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.M00176.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB187.69.2e-5919114297
             NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 
                       reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisfvt+easdkcqrekrktingddllwa++tlGfedyv+plkvyl+kyre+e
  Migut.M00176.1.p  19 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDLLWAMTTLGFEDYVDPLKVYLAKYREIE 111
                       89******************************************************************************************* PP

             NF-YB  95 gek 97 
                       gek
  Migut.M00176.1.p 112 GEK 114
                       *97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.2E-5413121IPR009072Histone-fold
SuperFamilySSF471131.86E-4021118IPR009072Histone-fold
PfamPF008086.6E-282488IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.6E-205270No hitNo description
PROSITE patternPS0068505571IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.6E-207189No hitNo description
PRINTSPR006151.6E-2090108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MADSDNDSGG HSNSNASSRE QDRFLPIANV SRIMKKALPA NAKISKDAKE TVQECVSEFI  60
SFVTGEASDK CQREKRKTIN GDDLLWAMTT LGFEDYVDPL KVYLAKYREI EGEKTSVAAV  120
KDAAGGGSAV TSGGGGYNGG GIYGGGGPVM GYHHGGQMYG GGGGFQHIGG GGNLDTTGSS  180
GSYGGGSGGG GATTGRQR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-4919109292Transcription factor HapC (Eurofung)
4g92_B1e-4919109292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012848260.11e-142PREDICTED: nuclear transcription factor Y subunit B-3
SwissprotO233104e-78NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLA0A022QLU91e-142A0A022QLU9_ERYGU; Uncharacterized protein
STRINGVIT_19s0015g00440.t014e-80(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.12e-68nuclear factor Y, subunit B3